PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881903.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 356aa    MW: 39592.4 Da    PI: 5.1288
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881903.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS292.21.4e-89473491261
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL++cA+ v+ g+ e+a+  L+++s+laspdgd+mqR+aayfteALa r+++ +++l kal++++ s  ++see+ + +lf+e++P+lk+s+
  XP_015881903.1  47 LIHLLIACANQVALGSIENANIGLEHISHLASPDGDTMQRIAAYFTEALADRMLKGWPGLHKALNSTKIS--SVSEEILVKRLFFELCPFLKLSY 139
                     689*************************************************************999998..6********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     l++NqaI ea+ege++vHiiD++ s+++QW++Llq+L++Rpegpp+lRiTg+++    +ke le+++ rL++ Ae+l++pf+fn+ v+++le+l+
  XP_015881903.1 140 LITNQAIIEAMEGEKMVHIIDLNSSEPAQWINLLQTLSARPEGPPHLRITGIHE----QKEVLEQMALRLTEEAEKLDIPFQFNP-VVSKLENLD 229
                     ******************************************************....9**************************.799****** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrll.................................................desvsleserdevLklvkslsP 236
                     +e+Lrvk+gEalaV++vlqlh ll                                                   svs + +  ++L  +++lsP
  XP_015881903.1 230 IESLRVKTGEALAVSSVLQLHCLLatdeenqrsppstsknlqkvfhlnqrtlgewlekdssyacnlspdsalsPLSVSASPRMGSFLTGIWGLSP 324
                     ********************************************************************99987555555557889********** PP

            GRAS 237 kvvvvveqeadhnsesFlerfleal 261
                     k++vv+eqe++hn+ +++er+l+ l
  XP_015881903.1 325 KLMVVTEQESNHNGLTLMERVLDML 349
                     *********************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.05621356IPR005202Transcription factor GRAS
PfamPF035144.8E-8747349IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MVQEEGSSSV TSSPLQFFPW MPVSPGVGGS PYPWLRELKS EERGLYLIHL LIACANQVAL  60
GSIENANIGL EHISHLASPD GDTMQRIAAY FTEALADRML KGWPGLHKAL NSTKISSVSE  120
EILVKRLFFE LCPFLKLSYL ITNQAIIEAM EGEKMVHIID LNSSEPAQWI NLLQTLSARP  180
EGPPHLRITG IHEQKEVLEQ MALRLTEEAE KLDIPFQFNP VVSKLENLDI ESLRVKTGEA  240
LAVSSVLQLH CLLATDEENQ RSPPSTSKNL QKVFHLNQRT LGEWLEKDSS YACNLSPDSA  300
LSPLSVSASP RMGSFLTGIW GLSPKLMVVT EQESNHNGLT LMERVLDMLT KTNLER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-24472844242GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881903.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR81e-149SCL3_ARATH; Scarecrow-like protein 3
TrEMBLB9GM400.0B9GM40_POPTR; Uncharacterized protein
STRINGPOPTR_0001s06090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-145scarecrow-like 3